TCP1 alpha Antibody / CCT1

  • Catalog number
    R31992
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    TCP1 alpha / CCT1
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB, IHC-P
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
  • Notes
    Optimal dilution of the TCP1 alpha antibody should be determined by the researcher.
  • Intented use
    This TCP1 alpha antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    P17987
  • Purity
    Antigen affinity
  • Description
    T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.
  • Immunogen
    Amino acids KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS of human T-complex protein 1 subunit alpha were used as the immunogen for the TCP1 alpha antibody.
  • Storage
    After reconstitution, the TCP1 alpha antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Cytoplasmic, membranous
  • Additional description
    The Anti-TCP1 alpha / CCT1 is a α- or alpha protein sometimes glycoprotein present in blood.
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    TCP1   alpha   CCT1  
  • Gene symbol
    TCP1, TRR-CCT1-1
  • Short name
    Anti-TCP1 alpha / CCT1
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to TCP1 alpha / CCT1
  • Alternative technique
    antibodies
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Arg (anticodon CCT) 1-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA arginine 8 (anticodon CCU)
    • transfer RNA-Arg (CCT) 1-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee