-
Target antigen
TCP1 alpha
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the TCP1 alpha Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The TCP1 alpha Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.
-
Related articles
1. "Entrez Gene: TCP1 t-complex 1". 2. Fonatsch C, Gradl G, Ragoussis J, Ziegler A (Oct 1987). "Assignment of the TCP1 locus to the long arm of human chromosome 6 by in situ hybridization". Cytogenet Cell Genet 45 (2): 109–12. 3. Willison K, Kelly A, Dudley K, Goodfellow P, Spurr N, Groves V, Gorman P, Sheer D, Trowsdale J (Nov 1987)."The human homologue of the mouse t-complex gene, TCP1, is located on chromosome 6 but is not near the HLA region". EMBO J 6 (7): 1967–74.
-
Gene Name
TCP1
-
Protein Name
T-complex protein 1 subunit alpha
-
Gene Full Name
t-complex 1
-
Synonyms
AI528772 antibody|c-cpn antibody|CCT alpha antibody|CCT antibody|CCT-alpha antibody|CCT1 antibody|Ccta antibody|CCTalpha antibody| D6S230E antibody|MGC133746 antibody|p63 antibody|T complex 1 antibody|T complex protein 1 alpha subunit antibody|T complex protein 1 antibody|T-complex homolog TCP1 antibody|T-complex protein 1 subunit alpha antibody|T-complex protein 1 subunit alpha B antibody| Tailless complex polypeptide 1 antibody|Tailless complex polypeptide 1A antibody|Tailless complex polypeptide 1B antibody|TCP 1 alpha antibody|Tcp-1 antibody|TCP-1-alpha antibody|TCP1 antibody|TCPA_HUMAN antibody|Tp63 antibody|TRic antibody
-
Uniprot ID
P17987
-
Entrez GeneID
6950
-
Description
The TCP1 alpha Antibody is a α- or alpha protein sometimes glycoprotein present in blood.
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
