SMURF2 Antibody
-
Catalog numberR32322
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenSMURF2
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the SMURF2 antibody should be determined by the researcher.
-
Intented useThis SMURF2 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotQ9HAU4
-
PurityAntigen affinity
-
DescriptionE3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression
-
ImmunogenAmino acids DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ of human SMURF2 were used as the immunogen for the SMURF2 antibody.
-
StorageAfter reconstitution, the SMURF2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolSMURF2
-
Short nameAnti-SMURF2
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to SMURF2
-
Alternative techniqueantibodies
-
Alternative to gene targetSMAD specific E3 ubiquitin protein ligase 2, SMURF2 and IDBG-64876 and ENSG00000108854 and 64750, SMAD binding, nuclei, Smurf2 and IDBG-213588 and ENSMUSG00000018363 and 66313, SMURF2 and IDBG-641903 and ENSBTAG00000019853 and 540826
-
Gene info
-
Identity
-
Gene
-
Long gene nameSMAD specific E3 ubiquitin protein ligase 2
-
GenBank acession
-
Locus
-
Discovery year2004-07-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- HECT domain containing
- C2 domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data