PML Antibody / Promyelocytic leukemia protein

  • Catalog number
    R32552
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    PML / Promyelocytic leukemia protein
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB, IHC-P
  • Recommended dilutions
    Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
  • Added buffer
    Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
  • Intented use
    This PML antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    P29590
  • Purity
    Antigen affinity
  • Description
    The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Immunogen
    Amino acids 141-179 (FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD) from the human protein were used as the immunogen for the PML antibody.
  • Storage
    After reconstitution, the PML antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Nuclear, cytoplasmic (isoform dependent)
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    PRAM1, PML
  • Short name
    Anti- PML / Promyelocytic leukemia protein
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to PML / Promyelocytic leukemia protein
  • Alternative technique
    antibodies
  • Alternative to gene target
    promyelocytic leukemia, MYL and PP8675 and RNF71 and TRIM19, PML and IDBG-21462 and ENSG00000140464 and 5371, cobalt ion binding, nuclei, Pml and IDBG-171712 and ENSMUSG00000036986 and 18854, PML and IDBG-631902 and ENSBTAG00000015779 and 100138545
  • Virus
    leukemia
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee