PML Protein Antibody

• Catalog number
  PB10085
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  PML Protein
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN), different from the related human sequence by six amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the PML Protein Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The PML Protein Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Related articles
  1. Dyck, J. A., Maul, G. G., Miller, W. H., Jr., Chen, J. D., Kakizuka, A., Evans, R. M. A novel macromolecular structure is a target of the promyelocyte-retinoic acid receptor oncoprotein. Cell 76: 333-343, 1994. 2. Giorgi, C., Ito, K., Lin, H.-K., Santangelo, C., Wieckowski, M. R., Lebiedzinska, M., Bononi, A., Bonora, M., Duszynski, J., Bernardi, R., Rizzuto, R., Tacchetti, C., Pinton, P., Pandolfi, P. P. PML regulates apoptosis at endoplasmic reticulum by modulating calcium release. Science 330: 1247-1251, 2010.
• Gene Name
  PML
• Protein Name
  Protein PML
• Gene Full Name
  promyelocytic leukemia
• Synonyms
  MYL | Pml | PP8675 | Protein PML | RNF 71 | TRIM 19 | P29590
• Uniprot ID
  Q60953
• Entrez GeneID
  18854
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PML   Protein  
• Gene symbol
  PRAM1, PML
• Short name
  PML Protein Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  promyelocytic leukemia Protein (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  promyelocytic leukemia, MYL and PP8675 and RNF71 and TRIM19, PML and IDBG-21462 and ENSG00000140464 and 5371, cobalt ion binding, nuclei, Pml and IDBG-171712 and ENSMUSG00000036986 and 18854, PML and IDBG-631902 and ENSBTAG00000015779 and 100138545

Gene info

• Identity
  HGNC:30091
• Gene
  PRAM1
• Long gene name
  PML-RARA regulated adaptor molecule 1
• Synonyms
  • PML-RAR
• GenBank acession
  • BC028012
• Locus
  19p13.2
• Discovery year
  2005-07-04
• Entrez gene record
  84106
• Pubmed identfication
  • 11301322
  • 15572693
• RefSeq identity
  • NM_032152
• VEGA ID
  OTTHUMG00000167924

Gene info

• Identity
  HGNC:9113
• Gene
  PML
• Long gene name
  PML nuclear body scaffold
• Synonyms gene name
  • promyelocytic leukemia
• Synonyms
  • MYL
  • TRIM19
  • RNF71
• GenBank acession
  • AB208950
• Locus
  15q24.1
• Discovery year
  1991-06-05
• Entrez gene record
  5371
• RefSeq identity
  • NM_002675
• Classification
  • Tripartite motif containing
  • Ring finger proteins
• VEGA ID
  OTTHUMG00000137607
• Locus Specific Databases
  • LRG_1069

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products