FMO1 Antibody

• Catalog number
  R32180
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  FMO1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the FMO1 antibody should be determined by the researcher.
• Intented use
  This FMO1 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q01740
• Purity
  Antigen affinity
• Description
  Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.
• Immunogen
  Amino acids AFPFLDESVVKVEDGQASLYKYIFPAHLQK of human FMO1 were used as the immunogen for the FMO1 antibody.
• Storage
  After reconstitution, the FMO1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  FMO1  
• Gene symbol
  FMO1
• Short name
  Anti-FMO1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to FMO1
• Alternative technique
  antibodies
• Alternative to gene target
  flavin containing monooxygenase 1, FMO1 and IDBG-104781 and ENSG00000010932 and 2326, N, Plasma membranes, Fmo1 and IDBG-202008 and ENSMUSG00000040181 and 14261, FMO1 and IDBG-632123 and ENSBTAG00000021408 and 508781

Gene info

• Identity
  HGNC:3769
• Gene
  FMO1
• Long gene name
  flavin containing dimethylaniline monoxygenase 1
• Synonyms gene name
  • flavin containing monooxygenase 1
• GenBank acession
  • M64082
• Locus
  1q24.3
• Discovery year
  1991-03-18
• Entrez gene record
  2326
• RefSeq identity
  • NM_002021
• Classification
  • Flavin containing monooxygenases
• VEGA ID
  OTTHUMG00000035502

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products