-
Target antigen
FMO1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the FMO1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The FMO1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.
-
Related articles
1. "Entrez Gene: FMO1 flavin containing monooxygenase 1". 2. Cashman JR (2004). "The implications of polymorphisms in mammalian flavin-containing monooxygenases in drug discovery and development".Drug Discov. Today 9 (13): 574–581. 3. Dolphin C, Shephard EA, Povey S et al. (1991). "Cloning, primary sequence, and chromosomal mapping of a human flavin-containing monooxygenase (FMO1)".J. Biol. Chem. 266 (19): 12379–85.
-
Gene Name
FMO1
-
Protein Name
Dimethylaniline monooxygenase [N-oxide-forming] 1
-
Gene Full Name
flavin containing monooxygenase 1
-
Synonyms
Dimethylaniline monooxygenase [N oxide forming] 1 antibody|Dimethylaniline monooxygenase [N-oxide-forming] 1 antibody|Dimethylaniline oxidase 1 antibody|Fetal hepatic flavin containing monooxygenase 1 antibody|Fetal hepatic flavin-containing monooxygenase 1 antibody| Flavin containing monooxygenase 1 (fetal liver) antibody|Flavin Containing Monooxygenase 1 antibody|FMO 1 antibody|FMO1 antibody| FMO1_HUMAN antibody|OTTHUMP00000033536 antibody|OTTHUMP00000033537 antibody
-
Uniprot ID
Q01740
-
Entrez GeneID
2326
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
