-
Category
Antibody
-
Concentration
0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
Form
Antigen affinity purified
-
Conjugation
Unconjugated
-
Clone
Polyclonal antibody
-
Recognised antigen
Eph Receptor B1 / EphB1
-
Host animal
Rabbit (Oryctolagus cuniculus)
-
Clonality
Polyclonal (rabbit origin)
-
Species reactivity
Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applications
WB, IHC-P
-
Recommended dilutions
Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
-
Notes
Optimal dilution of the EPHB1 antibody should be determined by the researcher.
-
Intented use
This EPHB1antibodyis to be used only for research purposes and not for diagnostics..
-
Uniprot
P54762
-
Purity
Antigen affinity
-
Description
Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.
-
Immunogen
Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody.
-
Storage
After reconstitution, the EPHB1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
Localization
Cytoplasmic, membrane
-
Properties
If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Additional description
The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translation
anticorps
