-
Category
Antibody
-
Concentration
0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
Form
Antigen affinity purified
-
Conjugation
Unconjugated
-
Clone
Polyclonal antibody
-
Recognised antigen
Angiotensin II type-2 receptor
-
Host animal
Rabbit (Oryctolagus cuniculus)
-
Clonality
Polyclonal (rabbit origin)
-
Species reactivity
Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applications
WB
-
Recommended dilutions
Western blot: 0.1-0.5ug/ml
-
Notes
Optimal dilution of the Angiotensin II type-2 receptor antibody should be determined by the researcher.
-
Intented use
This Angiotensin II type-2 receptor antibodyis to be used only for research purposes and not for diagnostics..
-
Uniprot
P50052
-
Purity
Antigen affinity
-
Description
AGTR2 is also known as angiotensin II receptor, type 2. The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation. The human AGTR2 gene is composed of three exons and spans at least 5 kb. Exons 1 and 2 encode for 5' untranslated mRNA sequence and exon 3 harbors the entire uninterrupted open reading frame.
-
Immunogen
Amino acids FRVPITWLQGKRESMSCRKSSSLREMETFVS of human AGTR2 were used as the immunogen for the Angiotensin II type-2 receptor antibody.
-
Storage
After reconstitution, the Angiotensin II type-2 receptor antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
Properties
If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Additional description
The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translation
anticorps