ABR Antibody / Active BCR related

  • Catalog number
    R32457
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    ABR / Active BCR related
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB, IHC-P
  • Recommended dilutions
    Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
  • Added buffer
    Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
  • Intented use
    This ABR antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    Q12979
  • Purity
    Antigen affinity
  • Description
    This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.
  • Immunogen
    Amino acids HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL from the human protein were used as the immunogen for the ABR antibody.
  • Storage
    Prior to reconstitution, store at 4oC. After reconstitution, the ABR antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Cytoplasmic, membranous
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    ABR   Active   BCR   related  
  • Gene symbol
    ABR, ABR-AS1, BCRP1, BCRP2, BCRP4, BCR
  • Short name
    Anti- ABR / Active BCR related
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to ABR / Active BCR related
  • Alternative technique
    antibodies
  • Alternative to gene target
    active BCR-related, MDB, ABR and IDBG-14430 and ENSG00000159842 and 29, Rac GTPase activator activity, Plasma membranes, Abr and IDBG-200937 and ENSMUSG00000017631 and 109934, ABR and IDBG-632555 and ENSBTAG00000008424 and 515556
Gene info
  • Identity
  • Gene
    ABR
  • Long gene name
    ABR activator of RhoGEF and GTPase
  • Synonyms gene name
    • active BCR-related gene
    • ABR, RhoGEF and GTPase activating protein
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1990-04-11
  • Entrez gene record
    29
  • Pubmed identfication
  • Classification
    • C2 domain containing
    • Dbl family Rho GEFs
    • Pleckstrin homology domain containing
    • MicroRNA protein coding host genes
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    ABR antisense RNA 1
  • Locus
  • Discovery year
    2021-07-01
  • Entrez gene record
  • Classification
    • Antisense RNAs
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
    BCR
  • Long gene name
    BCR activator of RhoGEF and GTPase
  • Synonyms gene
  • Synonyms gene name
    • breakpoint cluster region
    • BCR, RhoGEF and GTPase activating protein
  • Synonyms
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
    613
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • C2 domain containing
    • My-T-BRC complex
    • Dbl family Rho GEFs
    • Pleckstrin homology domain containing
  • VEGA ID
  • Locus Specific Databases
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee