ABR Antibody

• Catalog number
  PB9972
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  ABR
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407aa HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL), different from the related mouse sequence by one amino acid.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the ABR Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The ABR Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.
• Related articles
  1. Heisterkamp, N., Kaartinen, V., van Soest, S., Bokoch, G. M., Groffen, J. Human ABR encodes a protein with GAP-rac activity and homology to the DBL nucleotide exchange factor domain. J. Biol. Chem. 268: 16903-16906, 1993. 2. Heisterkamp, N., Morris, C., Groffen, J. ABR, an active BCR-related gene. Nucleic Acids Res. 17: 8821-8831, 1989. 3. McDonald, J. D., Daneshvar, L., Willert, J. R., Matsumura, K., Waldman, F., Cogen, P. H. Physical mapping of chromosome 17p13.3 in the region of a putative tumor suppressor gene important in medulloblastoma. Genomics 23: 229-232, 1994.
• Gene Name
  ABR
• Protein Name
  Active breakpoint cluster region-related protein
• Gene Full Name
  active BCR-related
• Synonyms
  abr | Active BCR related gene | MDB | Q12979
• Uniprot ID
  Q12979
• Entrez GeneID
  29
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ABR  
• Gene symbol
  ABR, ABR-AS1
• Short name
  ABR Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  active BCR-related (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  active BCR-related, MDB, ABR and IDBG-14430 and ENSG00000159842 and 29, Rac GTPase activator activity, Plasma membranes, Abr and IDBG-200937 and ENSMUSG00000017631 and 109934, ABR and IDBG-632555 and ENSBTAG00000008424 and 515556

Gene info

• Identity
  HGNC:81
• Gene
  ABR
• Long gene name
  ABR activator of RhoGEF and GTPase
• Synonyms gene name
  • active BCR-related gene
  • ABR, RhoGEF and GTPase activating protein
• Synonyms
  • MDB
• GenBank acession
  • L19704
• Locus
  17p13.3
• Discovery year
  1990-04-11
• Entrez gene record
  29
• Pubmed identfication
  • 2587217
  • 7479768
  • 17116687
• Classification
  • C2 domain containing
  • Dbl family Rho GEFs
  • Pleckstrin homology domain containing
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000090313

Gene info

• Identity
  HGNC:55674
• Gene
  ABR-AS1
• Long gene name
  ABR antisense RNA 1
• Locus
  17p13.3
• Discovery year
  2021-07-01
• Entrez gene record
  105371479
• Classification
  • Antisense RNAs

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products