Beta-Defensin-2 (a.a. 4-41) Peptide[Defensin, beta-2 (a.a. 4-41), Human]

  • Catalog number
    MBS318034
  • Price
    Please ask
  • Size
    NA
  • Products_type
    Peptide
  • Description
    human, mouse or other beta β- and alpha α- defensins are expressed by neutrophils ( α- ), lymphocytes and epithelial cells. DEFA DEFB genes defend the host against pathogens. GENTAUR supplies anti-defensins, monclonals, polyclonals antisera and recombinant DEFs or peptides of defensin. Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Gene target
  • Gene symbol
    SNORD115-41, IGHV3-41, IGLVVII-41-1, IGLV1-41, IGKV6D-41, CCDC18, TRIM71, RNU6-41P, MIR1302-4, METTL25B
  • Short name
    Beta-Defensin-2 (a a. 4-41) Peptide[Defensin, beta-2 (a a. 4-41), ]
  • Technique
    peptide, peptides
  • Host
    Synthetic human beta-Defensin 2 peptide (a.a. 4-41) , (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
  • Species
    Human, Humans
  • Alternative name
    b-Defensin-2 (a.a. 4-41) short protein sequence[Defensin, b-2 (a.a. 4-41), H. sapiens]
  • Alternative technique
    peptides
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable 3-41 (pseudogene)
  • Synonyms gene name
    • immunoglobulin heavy variable 3-41
    • immunoglobulin heavy variable 3-41 pseudogene
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-04
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin heavy locus at 14q32.33
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin lambda variable (VII)-41-1 (pseudogene)
  • Synonyms gene name
    • immunoglobulin lambda variable (VII)-41-1
    • immunoglobulin lambda variable (VII)-41-1 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2001-05-15
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin lambda locus at 22q11.2
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin lambda variable 1-41 (pseudogene)
  • Synonyms gene name
    • immunoglobulin lambda variable 1-41
    • immunoglobulin lambda variable 1-41 pseudogene
  • GenBank acession
  • Locus
  • Discovery year
    2000-05-08
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin lambda locus at 22q11.2
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 6D-41 (non-functional)
  • Synonyms gene name
    • immunoglobulin kappa variable 6D-41
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin kappa locus at 2p11.2
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    tripartite motif containing 71
  • Synonyms gene name
    • tripartite motif containing 71, E3 ubiquitin protein ligase
  • Synonyms
  • Locus
  • Discovery year
    2006-03-30
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Ring finger proteins
    • Tripartite motif containing
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    RNA, U6 small nuclear 41, pseudogene
  • Synonyms gene
  • Synonyms gene name
    • RNA, U6 small nuclear 41
  • Locus
  • Discovery year
    2008-06-10
  • Entrez gene record
Gene info
Gene info
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee