VDR Blocking Peptide

• Catalog number
  33R-4052
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Cell Biology
• Residues
  ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  VDR  
• Gene symbol
  VDR
• Short name
  VDR Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of VDR antibody, catalog no. 70R-1930
• Alternative technique
  control, peptides
• Alternative to gene target
  vitamin D (1,25- dihydroxyvitamin D3) receptor, NR1I1 and PPP1R163, VDR and IDBG-29237 and ENSG00000111424 and 7421, lithocholic acid binding, nuclei, Vdr and IDBG-179227 and ENSMUSG00000022479 and 22337, VDR and IDBG-633008 and ENSBTAG00000016414 and 533656

Gene info

• Identity
  HGNC:12679
• Gene
  VDR
• Long gene name
  vitamin D receptor
• Synonyms gene name
  • vitamin D (1,25- dihydroxyvitamin D3) receptor
• Synonyms
  • NR1I1
  • PPP1R163
• Synonyms name
  • protein phosphatase 1, regulatory subunit 163
  • 1,25- dihydroxyvitamin D3 receptor
• GenBank acession
  • J03258
• Locus
  12q13.11
• Discovery year
  1989-06-30
• Entrez gene record
  7421
• Pubmed identfication
  • 1662663
• Classification
  • Protein phosphatase 1 regulatory subunits
  • Nuclear receptor subfamily 1 group I
• VEGA ID
  OTTHUMG00000169890
• Locus Specific Databases
  • ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Similar products