Rabbit VDR antibody

• Catalog number
  70R-1930
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  VDR antibody was raised using the N terminal of VDR corresponding to a region with amino acids ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP
• Specificity
  VDR antibody was raised against the N terminal of VDR
• Cross Reactivity
  Human, Mouse, Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VDR antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  VDR  
• Gene symbol
  VDR
• Short name
  Rabbit VDR antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal VDR antibody raised against the N terminal of VDR
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  vitamin D (1,25- dihydroxyvitamin D3) receptor, NR1I1 and PPP1R163, VDR and IDBG-29237 and ENSG00000111424 and 7421, lithocholic acid binding, nuclei, Vdr and IDBG-179227 and ENSMUSG00000022479 and 22337, VDR and IDBG-633008 and ENSBTAG00000016414 and 533656

Gene info

• Identity
  HGNC:12679
• Gene
  VDR
• Long gene name
  vitamin D receptor
• Synonyms gene name
  • vitamin D (1,25- dihydroxyvitamin D3) receptor
• Synonyms
  • NR1I1
  • PPP1R163
• Synonyms name
  • protein phosphatase 1, regulatory subunit 163
  • 1,25- dihydroxyvitamin D3 receptor
• GenBank acession
  • J03258
• Locus
  12q13.11
• Discovery year
  1989-06-30
• Entrez gene record
  7421
• Pubmed identfication
  • 1662663
• Classification
  • Protein phosphatase 1 regulatory subunits
  • Nuclear receptor subfamily 1 group I
• VEGA ID
  OTTHUMG00000169890
• Locus Specific Databases
  • ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products