TARBP2 antibody

• Catalog number
  70R-1374
• Price
  Please ask
• Size
  100 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  DNA & RNA
• Type of Immunogen
  TARBP2 antibodies were raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT
• Raised in
  Rabbit
• Cross Reactivity
  Human, Mouse, Rat, ZebraFish
• Method of Purification
  Total IgG Protein A purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TARBP2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 2.5 ug/ml
• Assay Information
  TARBP2 Blocking Peptide, catalog no. 33R-1405, is also available for use as a blocking control in assays to test for specificity of this TARBP2 antibody
• Additional Information
  This is a rabbit polyclonal antibody against TARBP2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  TARBP2  
• Gene symbol
  TARBP2
• Short name
  TARBP2 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal TARBP2 antibody
• Alternative technique
  antibodies
• Alternative to gene target
  TAR (HIV-1) RNA binding protein 2, LOQS and TRBP and TRBP1 and TRBP2, TARBP2 and IDBG-36938 and ENSG00000139546 and 6895, protein homodimerization activity, nuclei, Tarbp2 and IDBG-188971 and ENSMUSG00000023051 and 21357, TARBP2 and IDBG-631247 and ENSBTAG00000000435 and 514674

Gene info

• Identity
  HGNC:11569
• Gene
  TARBP2
• Long gene name
  TARBP2 subunit of RISC loading complex
• Synonyms gene name
  • TAR (HIV-1) RNA binding protein 2
  • TARBP2, RISC loading complex RNA binding subunit
• Synonyms
  • Trbp
• Locus
  12q13.13
• Discovery year
  1994-04-12
• Entrez gene record
  6895
• Pubmed identfication
  • 2011739
  • 26582366
• Classification
  • RISC loading complex
• VEGA ID
  OTTHUMG00000169855

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products