Rabbit TARBP2 antibody
-
Catalog number70R-1374
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenTARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT
-
SpecificityNA
-
Cross ReactivityHuman, Mouse, Rat, ZebraFish
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TARBP2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTARBP2
-
Short nameRabbit TARBP2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TARBP2 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetTAR (HIV-1) RNA binding protein 2, LOQS and TRBP and TRBP1 and TRBP2, TARBP2 and IDBG-36938 and ENSG00000139546 and 6895, protein homodimerization activity, nuclei, Tarbp2 and IDBG-188971 and ENSMUSG00000023051 and 21357, TARBP2 and IDBG-631247 and ENSBTAG00000000435 and 514674
-
Gene info
-
Identity
-
Gene
-
Long gene nameTARBP2 subunit of RISC loading complex
-
Synonyms gene name
- TAR (HIV-1) RNA binding protein 2
- TARBP2, RISC loading complex RNA binding subunit
-
Synonyms
-
Locus
-
Discovery year1994-04-12
-
Entrez gene record
-
Pubmed identfication
-
Classification
- RISC loading complex
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data