SIP1 antibody
-
Catalog number70R-4677
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchNeuroscience
-
Type of ImmunogenSIP1 antibodies were raised using the middle region of SIP1 corresponding to a region with amino acids HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
-
Raised inRabbit
-
SpecificitySIP1 antibody was raised against the middle region of SIP1
-
Cross ReactivityHuman
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIP1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationSIP1 Blocking Peptide, catalog no. 33R-3856, is also available for use as a blocking control in assays to test for specificity of this SIP1 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against SIP1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolGEMIN2, ZEB2, SCAF11
-
Short nameSIP1 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal SIP1 antibody raised against the middle region of SIP1
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namegem nuclear organelle associated protein 2
-
Synonyms gene
-
Synonyms gene name
- survival of motor neuron protein interacting protein 1
- gem (nuclear organelle) associated protein 2
-
GenBank acession
-
Locus
-
Discovery year1998-10-16
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Gemins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namezinc finger E-box binding homeobox 2
-
Synonyms gene
-
Synonyms gene name
- zinc finger homeobox 1b
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-03-14
-
Entrez gene record
-
RefSeq identity
-
Classification
- ZF class homeoboxes and pseudogenes
- Zinc fingers C2H2-type
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameSR-related CTD associated factor 11
-
Synonyms gene
-
Synonyms gene name
- splicing factor, arginine/serine-rich 2, interacting protein
- serine/arginine-rich splicing factor 2, interacting protein
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-05-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ring finger proteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data