SH3GL2 antibody

• Catalog number
  70R-5258
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  SH3GL2 antibodies were raised using the middle region of SH3GL2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
• Raised in
  Rabbit
• Specificity
  SH3GL2 antibody was raised against the middle region of SH3GL2
• Cross Reactivity
  Human,Mouse
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH3GL2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  SH3GL2 Blocking Peptide, catalog no. 33R-7338, is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody
• Additional Information
  This is a rabbit polyclonal antibody against SH3GL2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  SH3GL2  
• Gene symbol
  SH3GL2
• Short name
  SH3GL2 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal SH3GL2 antibody raised against the middle region of SH3GL2
• Alternative technique
  antibodies
• Alternative to gene target
  SH3-domain GRB2-like 2, CNSA2 and EEN-B1 and SH3D2A and SH3P4, SH3GL2 and IDBG-51983 and ENSG00000107295 and 6456, identical protein binding, Plasma membranes, Sh3gl2 and IDBG-160703 and ENSMUSG00000028488 and 20404, SH3GL2 and IDBG-630570 and ENSBTAG00000014103 and 512450

Gene info

• Identity
  HGNC:10831
• Gene
  SH3GL2
• Long gene name
  SH3 domain containing GRB2 like 2, endophilin A1
• Synonyms gene name
  • SH3 domain containing GRB2 like 2
• Synonyms
  • SH3P4
  • SH3D2A
  • CNSA2
  • EEN-B1
• Synonyms name
  • endophilin-A1
• GenBank acession
  • X99657
• Locus
  9p22.2
• Discovery year
  1996-10-26
• Entrez gene record
  6456
• Pubmed identfication
  • 9169142
• RefSeq identity
  • NM_003026
• Classification
  • N-BAR domain containing
• VEGA ID
  OTTHUMG00000019601

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products