Rabbit SH3GL2 antibody

• Catalog number
  70R-5258
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  SH3GL2 antibody was raised using the middle region of SH3GL2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
• Specificity
  SH3GL2 antibody was raised against the middle region of SH3GL2
• Cross Reactivity
  Human,Mouse
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH3GL2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  SH3GL2  
• Gene symbol
  SH3GL2
• Short name
  Rabbit SH3GL2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal SH3GL2 antibody raised against the middle region of SH3GL2
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  SH3-domain GRB2-like 2, CNSA2 and EEN-B1 and SH3D2A and SH3P4, SH3GL2 and IDBG-51983 and ENSG00000107295 and 6456, identical protein binding, Plasma membranes, Sh3gl2 and IDBG-160703 and ENSMUSG00000028488 and 20404, SH3GL2 and IDBG-630570 and ENSBTAG00000014103 and 512450

Gene info

• Identity
  HGNC:10831
• Gene
  SH3GL2
• Long gene name
  SH3 domain containing GRB2 like 2, endophilin A1
• Synonyms gene name
  • SH3 domain containing GRB2 like 2
• Synonyms
  • SH3P4
  • SH3D2A
  • CNSA2
  • EEN-B1
• Synonyms name
  • endophilin-A1
• GenBank acession
  • X99657
• Locus
  9p22.2
• Discovery year
  1996-10-26
• Entrez gene record
  6456
• Pubmed identfication
  • 9169142
• RefSeq identity
  • NM_003026
• Classification
  • N-BAR domain containing
• VEGA ID
  OTTHUMG00000019601

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products