RXRA antibody

• Catalog number
  70R-1922
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  RXRA antibodies were raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
• Raised in
  Rabbit
• Specificity
  RXRA antibody was raised against the N terminal of RXRA
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RXRA antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  RXRA Blocking Peptide, catalog no. 33R-2196, is also available for use as a blocking control in assays to test for specificity of this RXRA antibody
• Additional Information
  This is a rabbit polyclonal antibody against RXRA, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  RXRA  
• Gene symbol
  RXRA
• Short name
  RXRA antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal RXRA antibody raised against the N terminal of RXRA
• Alternative technique
  antibodies
• Alternative to gene target
  retinoid X receptor, alpha, NR2B1, RXRA and IDBG-91747 and ENSG00000186350 and 6256, vitamin D response element binding, nuclei, Rxra and IDBG-151388 and ENSMUSG00000015846 and 20181, BT.78456 and IDBG-641227 and ENSBTAG00000017851 and 507554

Gene info

• Identity
  HGNC:10477
• Gene
  RXRA
• Long gene name
  retinoid X receptor alpha
• Synonyms gene name
  • retinoid X receptor, alpha
• Synonyms
  • NR2B1
• Synonyms name
  • nuclear receptor subfamily 2 group B member 1
• GenBank acession
  • X52773
• Locus
  9q34.2
• Discovery year
  1991-11-14
• Entrez gene record
  6256
• Pubmed identfication
  • 2159111
• RefSeq identity
  • NM_002957
• Classification
  • Retinoid X receptors
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000020887

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products