Rabbit RXRA antibody
-
Catalog number70R-1922
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenRXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
-
SpecificityRXRA antibody was raised against the N terminal of RXRA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RXRA antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRXRA
-
Short nameRabbit RXRA antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RXRA antibody raised against the N terminal of RXRA
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetretinoid X receptor, alpha, NR2B1, RXRA and IDBG-91747 and ENSG00000186350 and 6256, vitamin D response element binding, nuclei, Rxra and IDBG-151388 and ENSMUSG00000015846 and 20181, BT.78456 and IDBG-641227 and ENSBTAG00000017851 and 507554
-
Gene info
-
Identity
-
Gene
-
Long gene nameretinoid X receptor alpha
-
Synonyms gene name
- retinoid X receptor, alpha
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1991-11-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Retinoid X receptors
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data