RHCE antibody

• Catalog number
  70R-7493
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Miscellaneous
• Type of Immunogen
  RHCE antibodies were raised using the N terminal of RHCE corresponding to a region with amino acids SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG
• Raised in
  Rabbit
• Specificity
  RHCE antibody was raised against the N terminal of RHCE
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHCE antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  RHCE Blocking Peptide, catalog no. 33R-8819, is also available for use as a blocking control in assays to test for specificity of this RHCE antibody
• Additional Information
  This is a rabbit polyclonal antibody against RHCE, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  RHCE  
• Gene symbol
  RHCE
• Short name
  RHCE antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal RHCE antibody raised against the N terminal of RHCE
• Alternative technique
  antibodies
• Alternative to gene target
  Rh blood group, CcEe antigens, CD240CE and RH and RH30A and Rh4 and RHC and RHE and RhIVb(J) and RHIXB and RHPI and RhVI and RhVIII, RHCE and IDBG-94329 and ENSG00000188672 and 6006, ammonium transmembrane transporter activity, Plasma membranes

Gene info

• Identity
  HGNC:10008
• Gene
  RHCE
• Long gene name
  Rh blood group CcEe antigens
• Synonyms gene
  • RH
• Synonyms gene name
  • Rhesus blood group, CcEe antigens
• Synonyms
  • CD240CE
• GenBank acession
  • BC075081
• Locus
  1p36.11
• Discovery year
  1993-10-22
• Entrez gene record
  6006
• Pubmed identfication
  • 8220426
• RefSeq identity
  • NM_020485
• Classification
  • Blood group antigens
  • CD molecules
• VEGA ID
  OTTHUMG00000007650
• Locus Specific Databases
  • Blood Group Antigen Mutation Database
  • LRG_797

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products