Rabbit RHCE antibody
-
Catalog number70R-7493
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaMiscellaneous
-
ImmunogenRHCE antibody was raised using the N terminal of RHCE corresponding to a region with amino acids SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG
-
SpecificityRHCE antibody was raised against the N terminal of RHCE
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHCE antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRHCE
-
Short nameRabbit RHCE antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RHCE antibody raised against the N terminal of RHCE
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRh blood group, CcEe antigens, CD240CE and RH and RH30A and Rh4 and RHC and RHE and RhIVb(J) and RHIXB and RHPI and RhVI and RhVIII, RHCE and IDBG-94329 and ENSG00000188672 and 6006, ammonium transmembrane transporter activity, Plasma membranes
-
Gene info
-
Identity
-
Gene
-
Long gene nameRh blood group CcEe antigens
-
Synonyms gene
-
Synonyms gene name
- Rhesus blood group, CcEe antigens
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1993-10-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Blood group antigens
- CD molecules
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data