Rabbit TREML2 antibody

• Catalog number
  70R-6395
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  TREML2 antibody was raised using the middle region of TREML2 corresponding to a region with amino acids TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST
• Specificity
  TREML2 antibody was raised against the middle region of TREML2
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TREML2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  TREML2  
• Gene symbol
  TREML2
• Short name
  Rabbit TREML2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal TREML2 antibody raised against the middle region of TREML2
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  triggering receptor expressed on myeloid cells-like 2, TREML2 and IDBG-86610 and ENSG00000112195 and 79865, protein binding, Cell surfaces, Treml2 and IDBG-189835 and ENSMUSG00000071068 and 328833, TREML2 and IDBG-630865 and ENSBTAG00000015707 and 515548

Gene info

• Identity
  HGNC:21092
• Gene
  TREML2
• Long gene name
  triggering receptor expressed on myeloid cells like 2
• Synonyms gene
  • C6orf76
• Synonyms gene name
  • chromosome 6 open reading frame 76
  • triggering receptor expressed on myeloid cells-like 2
• Synonyms
  • FLJ13693
  • TLT2
  • dJ238O23.1
• Synonyms name
  • TREM-like transcript 2
• GenBank acession
  • AK023755
• Locus
  6p21.1
• Discovery year
  2003-05-19
• Entrez gene record
  79865
• Pubmed identfication
  • 12645956
• RefSeq identity
  • NM_024807
• Classification
  • V-set domain containing
• VEGA ID
  OTTHUMG00000016349

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products