Rabbit TNFRSF21 antibody

• Catalog number
  70R-7549
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Cycle & Cell Death
• Immunogen
  TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV
• Specificity
  TNFRSF21 antibody was raised against the N terminal of TNFRSF21
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNFRSF21 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  TNFRSF21  
• Gene symbol
  TNFRSF21
• Short name
  Rabbit TNFRSF21 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal TNFRSF21 antibody raised against the N terminal of TNFRSF21
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  tumor necrosis factor receptor superfamily, member 21, TNFRSF21 and IDBG-90063 and ENSG00000146072 and 27242, protein binding, Plasma membranes, Tnfrsf21 and IDBG-184035 and ENSMUSG00000023915 and 94185, TNFRSF21 and IDBG-632394 and ENSBTAG00000020054 and 537922

Gene info

• Identity
  HGNC:13469
• Gene
  TNFRSF21
• Long gene name
  TNF receptor superfamily member 21
• Synonyms gene name
  • tumor necrosis factor receptor superfamily, member 21
• Synonyms
  • DR6
  • CD358
• Synonyms name
  • death receptor 6
• GenBank acession
  • AF068868
• Locus
  6p12.3
• Discovery year
  2001-07-27
• Entrez gene record
  27242
• Pubmed identfication
  • 9714541
• RefSeq identity
  • NM_014452
• Classification
  • Tumor necrosis factor receptor superfamily
  • CD molecules
• VEGA ID
  OTTHUMG00000014796

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products