Rabbit TIRAP antibody

• Catalog number
  70R-5827
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  TIRAP antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TIRAP antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  TIRAP  
• Gene symbol
  TIRAP
• Short name
  Rabbit TIRAP antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal TIRAP antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  toll-interleukin 1 receptor (TIR) domain containing adaptor protein, TIRAP and IDBG-75811 and ENSG00000150455 and 114609, phosphatidylinositol-4, Plasma membranes, Tirap and IDBG-148134 and ENSMUSG00000032041 and 117149, TIRAP and IDBG-642760 and ENSBTAG00000021504 and 531079

Gene info

• Identity
  HGNC:17192
• Gene
  TIRAP
• Long gene name
  TIR domain containing adaptor protein
• Synonyms gene name
  • Toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
• Synonyms
  • Mal
  • wyatt
• Synonyms name
  • MyD88 adapter-like
• GenBank acession
  • AF378129
• Locus
  11q24.2
• Discovery year
  2003-06-05
• Entrez gene record
  114609
• Pubmed identfication
  • 11526399
  • 11544529
• RefSeq identity
  • NM_148910
• Classification
  • TIR domain containing
• VEGA ID
  OTTHUMG00000140373

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products