Rabbit SOD2 antibody
-
Catalog number70R-5749
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenSOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH
-
SpecificitySOD2 antibody was raised against the N terminal of SOD2
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOD2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSOD2-OT1, SOD2, GCASPC
-
Short nameRabbit SOD2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SOD2 antibody raised against the N terminal of SOD2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsuperoxide dismutase 2, mitochondrial, IPOB and MNSOD and MVCD6, SOD2 and IDBG-98553 and ENSG00000112096 and 100129518,6648, metal ion binding, Cytoplasm, Sod2 and IDBG-137806 and ENSMUSG00000006818 and 20656, SOD2 and IDBG-635443 and ENSBTAG00000006523 and 281496
-
Gene info
-
Identity
-
Gene
-
Long gene nameSOD2 overlapping transcript 1
-
Locus
-
Discovery year2017-04-19
-
Entrez gene record
-
RefSeq identity
-
Classification
- Overlapping transcripts
Gene info
-
Identity
-
Gene
-
Long gene namesuperoxide dismutase 2
-
Synonyms gene name
- superoxide dismutase 2, mitochondrial
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1986-01-01
-
Entrez gene record
-
RefSeq identity
-
Classification
- Superoxide dismutases
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene namegall bladder cancer associated suppressor of pyruvate carboxylase lncRNA
-
Synonyms
-
Locus
-
Discovery year2016-08-04
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Long non-coding RNAs with non-systematic symbols
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data