gentaur logogentaur logo
x

SOD2 antibody

  • Catalog number
    70R-5749
  • Product name
    SOD2 antibody
  • Size
    50 µg
  • Price
    Ask For Price
  • Contact us
    SOD2 antibody
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Proteases, Inhibitors, & Enzymes
  • Type of Immunogen
    SOD2 antibodies were raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH
  • Raised in
    Rabbit
  • Specificity
    SOD2 antibody was raised against the N terminal of SOD2
  • Cross Reactivity
    Human
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOD2 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    SOD2 Blocking Peptide, catalog no. 33R-6219, is also available for use as a blocking control in assays to test for specificity of this SOD2 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against SOD2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Alternative to gene target
    • [ "superoxide dismutase 2, mitochondrial", "IPOB and MNSOD and MVCD6", "SOD2 and IDBG-98553 and ENSG00000112096 and 100129518,6648", "metal ion binding", "Cytoplasm", "Sod2 and IDBG-137806 and ENSMUSG00000006818 and 20656", "SOD2 and IDBG-635443 and ENSBTAG00000006523 and 281496" ]
  • Gene target
    SOD2
    • Gene info
    • Identity:HGNC:53445
    • Gene:SOD2-OT1
    • Long gene name:SOD2 overlapping transcript 1
    • Discovery year:2017-04-19
    • Entrez gene record:100129518
    • RefSeq identity:NR_037166
    • Classification:Overlapping transcripts
    Gene info
    Locus Specific Databases:ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database
    Gene info
  • Gene symbol
    SOD2-OT1, SOD2, GCASPC
  • Short name
    SOD2 antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies