Rabbit SH3KBP1 antibody
-
Catalog number70R-4573
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenSH3KBP1 antibody was raised using the N terminal of SH3KBP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS
-
SpecificitySH3KBP1 antibody was raised against the N terminal of SH3KBP1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH3KBP1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSH3KBP1
-
Short nameRabbit SH3KBP1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SH3KBP1 antibody raised against the N terminal of SH3KBP1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetSH3-domain kinase binding protein 1, SH3KBP1 and IDBG-49936 and ENSG00000147010 and 30011, SH3 domain binding, Cell surfaces, Sh3kbp1 and IDBG-182475 and ENSMUSG00000040990 and 58194, BT.104277 and IDBG-638563 and ENSBTAG00000003727 and 510489
-
Gene info
-
Identity
-
Gene
-
Long gene nameSH3 domain containing kinase binding protein 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-12-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data