Rabbit RPS6KA2 antibody

  • Catalog number
    70R-5759
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Cell Biology
  • Immunogen
    RPS6KA2 antibody was raised using the middle region of RPS6KA2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR
  • Specificity
    RPS6KA2 antibody was raised against the middle region of RPS6KA2
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPS6KA2 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    RPS6KA2  
  • Gene symbol
    RPS6KA2-AS1, RPS6KA2-IT1, RPS6KA2
  • Short name
    Rabbit RPS6KA2 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal RPS6KA2 antibody raised against the middle region of RPS6KA2
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    ribosomal protein S6 kinase, 90kDa, polypeptide 2, HU-2 and MAPKAPK1C and p90-RSK3 and pp90RSK3 and RSK and RSK3 and S6K-alpha and S6K-alpha2, RPS6KA2 and IDBG-98954 and ENSG00000071242 and 6196, transferase activity, nuclei, Rps6ka2 and IDBG-134649 and ENSMUSG00000023809 and 20112, RPS6KA2 and IDBG-635849 and ENSBTAG00000021741 and 517953
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    RPS6KA2 intronic transcript 1
  • Synonyms gene name
    • RPS6KA2 intronic transcript 1 (non-protein coding)
  • Locus
  • Discovery year
    2011-05-24
  • Classification
    • Intronic transcripts
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    ribosomal protein S6 kinase A2
  • Synonyms gene name
    • ribosomal protein S6 kinase, 90kD, polypeptide 2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1994-07-11
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • MicroRNA protein coding host genes
    • AGC family kinases
    • MAPK activated protein kinases
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee