RPS6KA2 antibody
#
-
Catalog number70R-5759
-
Price:
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchCell Biology
-
Type of ImmunogenRPS6KA2 antibodies were raised using the middle region of RPS6KA2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR
-
Raised inRabbit
-
SpecificityRPS6KA2 antibody was raised against the middle region of RPS6KA2
-
Cross ReactivityHuman,Mouse,Rat
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPS6KA2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationRPS6KA2 Blocking Peptide, catalog no. 33R-5450, is also available for use as a blocking control in assays to test for specificity of this RPS6KA2 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against RPS6KA2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolRPS6KA2-AS1, RPS6KA2-IT1, RPS6KA2
-
Short nameRPS6KA2 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal RPS6KA2 antibody raised against the middle region of RPS6KA2
-
Alternative techniqueantibodies
-
Alternative to gene targetribosomal protein S6 kinase, 90kDa, polypeptide 2, HU-2 and MAPKAPK1C and p90-RSK3 and pp90RSK3 and RSK and RSK3 and S6K-alpha and S6K-alpha2, RPS6KA2 and IDBG-98954 and ENSG00000071242 and 6196, transferase activity, nuclei, Rps6ka2 and IDBG-134649 and ENSMUSG00000023809 and 20112, RPS6KA2 and IDBG-635849 and ENSBTAG00000021741 and 517953
-
Gene info
-
Identity
-
Gene
-
Long gene nameRPS6KA2 antisense RNA 1
-
Synonyms gene name
- RPS6KA2 antisense RNA 1 (non-protein coding)
-
GenBank acession
-
Locus
-
Discovery year2012-01-25
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameRPS6KA2 intronic transcript 1
-
Synonyms gene name
- RPS6KA2 intronic transcript 1 (non-protein coding)
-
Locus
-
Discovery year2011-05-24
-
Classification
- Intronic transcripts
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameribosomal protein S6 kinase A2
-
Synonyms gene name
- ribosomal protein S6 kinase, 90kD, polypeptide 2
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1994-07-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- MicroRNA protein coding host genes
- AGC family kinases
- MAPK activated protein kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data