Rabbit PCDHGC3 antibody
-
Catalog number70R-6138
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenPCDHGC3 antibody was raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY
-
SpecificityPCDHGC3 antibody was raised against the N terminal of PCDHGC3
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHGC3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPCDHGC3
-
Short nameRabbit PCDHGC3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PCDHGC3 antibody raised against the N terminal of PCDHGC3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprotocadherin gamma subfamily C, 3, PC43 and PCDH-GAMMA-C3 and PCDH2, PCDHGC3 and IDBG-408922 and ENSG00000240184 and 5098, calcium ion binding, Plasma membranes, Pcdhac2 and IDBG-139382 and ENSMUSG00000007440 and 116731,12936,12942,12943,192161,192164,353234,353236,353237, PCDHGC3 and IDBG-646108 and ENSBTAG00000017349 and 100125301,521340,532241
-
Gene info
-
Identity
-
Gene
-
Long gene nameprotocadherin gamma subfamily C, 3
-
Synonyms gene
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-08-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Clustered protocadherins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data