PCDHGC3 antibody

• Catalog number
  70R-6138
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  PCDHGC3 antibodies were raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY
• Raised in
  Rabbit
• Specificity
  PCDHGC3 antibody was raised against the N terminal of PCDHGC3
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHGC3 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  PCDHGC3 Blocking Peptide, catalog no. 33R-4148, is also available for use as a blocking control in assays to test for specificity of this PCDHGC3 antibody
• Additional Information
  This is a rabbit polyclonal antibody against PCDHGC3, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PCDHGC3  
• Gene symbol
  PCDHGC3
• Short name
  PCDHGC3 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal PCDHGC3 antibody raised against the N terminal of PCDHGC3
• Alternative technique
  antibodies
• Alternative to gene target
  protocadherin gamma subfamily C, 3, PC43 and PCDH-GAMMA-C3 and PCDH2, PCDHGC3 and IDBG-408922 and ENSG00000240184 and 5098, calcium ion binding, Plasma membranes, Pcdhac2 and IDBG-139382 and ENSMUSG00000007440 and 116731,12936,12942,12943,192161,192164,353234,353236,353237, PCDHGC3 and IDBG-646108 and ENSBTAG00000017349 and 100125301,521340,532241

Gene info

• Identity
  HGNC:8716
• Gene
  PCDHGC3
• Long gene name
  protocadherin gamma subfamily C, 3
• Synonyms gene
  • PCDH2
• Synonyms
  • PC-43
  • PC43
  • PCDH-GAMMA-C3
• Synonyms name
  • cadherin-like 2
  • protocadherin 2
  • protocadherin 43
• GenBank acession
  • AF152337
• Locus
  5q31.3
• Discovery year
  2000-08-22
• Entrez gene record
  5098
• Pubmed identfication
  • 9360932
  • 8508762
• RefSeq identity
  • NM_002588
• Classification
  • Clustered protocadherins
• VEGA ID
  OTTHUMG00000129613

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products