Rabbit PARD3 antibody
-
Catalog number70R-5678
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenPARD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNR
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARD3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPARD3-DT, PARD3
-
Short nameRabbit PARD3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PARD3 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpar-3 partitioning defective 3 homolog (C. elegans), PARD3 and IDBG-69007 and ENSG00000148498 and 56288, phosphatidylinositol-4, Cell surfaces, Pard3 and IDBG-200951 and ENSMUSG00000025812 and 93742, PARD3 and IDBG-637236 and ENSBTAG00000014991 and 527964
-
Gene info
-
Identity
-
Gene
-
Long gene namePARD3 divergent transcript
-
Synonyms gene
-
Synonyms gene name
- PARD3 antisense RNA 1
-
Locus
-
Discovery year2012-12-20
-
Entrez gene record
-
Classification
- Divergent transcripts
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namepar-3 family cell polarity regulator
-
Synonyms gene name
- par-3 (partitioning defective 3, C.elegans) homolog
- par-3 partitioning defective 3 homolog (C. elegans)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-07-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- PDZ domain containing
- Protein phosphatase 1 regulatory subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data