Rabbit P2RX1 antibody
-
Catalog number70R-1546
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenP2RX1 antibody was raised using the middle region of P2RX1 corresponding to a region with amino acids VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG
-
SpecificityP2RX1 antibody was raised against the middle region of P2RX1
-
Cross ReactivityHuman,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of P2RX1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolP2RX1
-
Short nameRabbit P2RX1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal P2RX1 antibody raised against the middle region of P2RX1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpurinergic receptor P2X, ligand-gated ion channel, 1, P2X1, P2RX1 and IDBG-18186 and ENSG00000108405 and 5023, zinc ion binding, nuclei, P2rx1 and IDBG-197393 and ENSMUSG00000020787 and 18436, P2RX1 and IDBG-633428 and ENSBTAG00000007169 and
-
Gene info
-
Identity
-
Gene
-
Long gene namepurinergic receptor P2X 1
-
Synonyms gene name
- purinergic receptor P2X, ligand-gated ion channel, 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-01-16
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Purinergic receptors P2X
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data