P2RX1 antibody

• Catalog number
  70R-1546
• Price
  Please ask
• Size
  100 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Neuroscience
• Type of Immunogen
  P2RX1 antibodies were raised using the middle region of P2RX1 corresponding to a region with amino acids VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG
• Raised in
  Rabbit
• Specificity
  P2RX1 antibody was raised against the middle region of P2RX1
• Cross Reactivity
  Human,Dog
• Method of Purification
  Total IgG Protein A purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of P2RX1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• Usage Recommendations
  WB: 2.5 ug/ml; IHC: 4-8 ug/ml
• Assay Information
  P2RX1 Blocking Peptide, catalog no. 33R-9880, is also available for use as a blocking control in assays to test for specificity of this P2RX1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against P2RX1. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  P2RX1  
• Gene symbol
  P2RX1
• Short name
  P2RX1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal P2RX1 antibody raised against the middle region of P2RX1
• Alternative technique
  antibodies
• Alternative to gene target
  purinergic receptor P2X, ligand-gated ion channel, 1, P2X1, P2RX1 and IDBG-18186 and ENSG00000108405 and 5023, zinc ion binding, nuclei, P2rx1 and IDBG-197393 and ENSMUSG00000020787 and 18436, P2RX1 and IDBG-633428 and ENSBTAG00000007169 and

Gene info

• Identity
  HGNC:8533
• Gene
  P2RX1
• Long gene name
  purinergic receptor P2X 1
• Synonyms gene name
  • purinergic receptor P2X, ligand-gated ion channel, 1
• Synonyms
  • P2X1
• GenBank acession
  • X83688
• Locus
  17p13.2
• Discovery year
  1997-01-16
• Entrez gene record
  5023
• Pubmed identfication
  • 8834001
• RefSeq identity
  • NM_002558
• Classification
  • Purinergic receptors P2X
• VEGA ID
  OTTHUMG00000177673

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products