Rabbit MBL2 antibody
-
Catalog number70R-4596
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenMBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
-
SpecificityMBL2 antibody was raised against the middle region of MBL2
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MBL2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMBL2, LNCAROD
-
Short nameRabbit MBL2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MBL2 antibody raised against the middle region of MBL2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmannose-binding lectin (protein C) 2, soluble, COLEC1 and HSMBPC and MBL and MBL2D and MBP and MBP-C and MBP1 and MBPD, MBL2 and IDBG-74690 and ENSG00000165471 and 4153, calcium-dependent protein binding, Extracellular, Mbl2 and IDBG-158106 and ENSMUSG00000024863 and 17195, MBL and IDBG-637084 and ENSBTAG00000007049 and 281297
-
Gene info
-
Identity
-
Gene
-
Long gene namemannose binding lectin 2
-
Synonyms gene
-
Synonyms gene name
- mannose-binding lectin (protein C) 2, soluble (opsonic defect)
- mannose-binding lectin (protein C) 2, soluble
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1990-05-25
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Complement system activation components
- Collectins
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene namelncRNA activating regulator of DKK1
-
Synonyms gene
-
Synonyms gene name
- long intergenic non-protein coding RNA 1468
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2014-07-28
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Long non-coding RNAs with non-systematic symbols
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data