MBL2 antibody
-
Catalog number70R-4596
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchSignal Transduction
-
Type of ImmunogenMBL2 antibodies were raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
-
Raised inRabbit
-
SpecificityMBL2 antibody was raised against the middle region of MBL2
-
Cross ReactivityHuman
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MBL2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationMBL2 Blocking Peptide, catalog no. 33R-4323, is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against MBL2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolMBL2, LNCAROD
-
Short nameMBL2 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal MBL2 antibody raised against the middle region of MBL2
-
Alternative techniqueantibodies
-
Alternative to gene targetmannose-binding lectin (protein C) 2, soluble, COLEC1 and HSMBPC and MBL and MBL2D and MBP and MBP-C and MBP1 and MBPD, MBL2 and IDBG-74690 and ENSG00000165471 and 4153, calcium-dependent protein binding, Extracellular, Mbl2 and IDBG-158106 and ENSMUSG00000024863 and 17195, MBL and IDBG-637084 and ENSBTAG00000007049 and 281297
-
Gene info
-
Identity
-
Gene
-
Long gene namemannose binding lectin 2
-
Synonyms gene
-
Synonyms gene name
- mannose-binding lectin (protein C) 2, soluble (opsonic defect)
- mannose-binding lectin (protein C) 2, soluble
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1990-05-25
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Complement system activation components
- Collectins
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene namelncRNA activating regulator of DKK1
-
Synonyms gene
-
Synonyms gene name
- long intergenic non-protein coding RNA 1468
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2014-07-28
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Long non-coding RNAs with non-systematic symbols
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data