Rabbit KRAS antibody

  • Catalog number
    70R-5673
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Cancer
  • Immunogen
    KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC
  • Specificity
    KRAS antibody was raised against the N terminal of KRAS
  • Cross Reactivity
    Human,Mouse,Rat,Drosophila
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRAS antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    KRAS  
  • Gene symbol
    KRAS
  • Short name
    Rabbit KRAS antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal KRAS antibody raised against the N terminal of KRAS
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog, C-K-RAS and CFC2 and K-RAS2A and K-RAS2B and K-RAS4A and K-RAS4B and KI-RAS and KRAS1 and KRAS2 and NS and NS3 and RASK2, KRAS and IDBG-23889 and ENSG00000133703 and 3845, protein complex binding, Plasma membranes, Kras and IDBG-197719 and ENSMUSG00000030265 and 16653, KRAS and IDBG-638783 and ENSBTAG00000009778 and 541140
Gene info
  • Identity
  • Gene
  • Long gene name
    KRAS proto-oncogene, GTPase
  • Synonyms gene
  • Synonyms gene name
    • v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog
    • v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
    • Kirsten rat sarcoma viral oncogene homolog
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1988-06-02
  • Entrez gene record
  • RefSeq identity
  • Classification
    • RAS type GTPase family
  • VEGA ID
  • Locus Specific Databases
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee