Rabbit KRAS antibody
-
Catalog number70R-5673
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenKRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC
-
SpecificityKRAS antibody was raised against the N terminal of KRAS
-
Cross ReactivityHuman,Mouse,Rat,Drosophila
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRAS antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolKRAS
-
Short nameRabbit KRAS antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal KRAS antibody raised against the N terminal of KRAS
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetv-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog, C-K-RAS and CFC2 and K-RAS2A and K-RAS2B and K-RAS4A and K-RAS4B and KI-RAS and KRAS1 and KRAS2 and NS and NS3 and RASK2, KRAS and IDBG-23889 and ENSG00000133703 and 3845, protein complex binding, Plasma membranes, Kras and IDBG-197719 and ENSMUSG00000030265 and 16653, KRAS and IDBG-638783 and ENSBTAG00000009778 and 541140
-
Gene info
-
Identity
-
Gene
-
Long gene nameKRAS proto-oncogene, GTPase
-
Synonyms gene
-
Synonyms gene name
- v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog
- v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
- Kirsten rat sarcoma viral oncogene homolog
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1988-06-02
-
Entrez gene record
-
RefSeq identity
-
Classification
- RAS type GTPase family
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data