KRAS antibody

  • Catalog number
    70R-5673
  • Price
    Please ask
  • Size
    50 µg
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Cancer
  • Type of Immunogen
    KRAS antibodies were raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC
  • Raised in
    Rabbit
  • Specificity
    KRAS antibody was raised against the N terminal of KRAS
  • Cross Reactivity
    Human,Mouse,Rat,Drosophila
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRAS antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    KRAS Blocking Peptide, catalog no. 33R-9058, is also available for use as a blocking control in assays to test for specificity of this KRAS antibody
  • Additional Information
    This is a rabbit polyclonal antibody against KRAS, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    KRAS  
  • Gene symbol
    KRAS
  • Short name
    KRAS antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Rabbit polyclonal KRAS antibody raised against the N terminal of KRAS
  • Alternative technique
    antibodies
  • Alternative to gene target
    v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog, C-K-RAS and CFC2 and K-RAS2A and K-RAS2B and K-RAS4A and K-RAS4B and KI-RAS and KRAS1 and KRAS2 and NS and NS3 and RASK2, KRAS and IDBG-23889 and ENSG00000133703 and 3845, protein complex binding, Plasma membranes, Kras and IDBG-197719 and ENSMUSG00000030265 and 16653, KRAS and IDBG-638783 and ENSBTAG00000009778 and 541140
Gene info
  • Identity
  • Gene
  • Long gene name
    KRAS proto-oncogene, GTPase
  • Synonyms gene
  • Synonyms gene name
    • v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog
    • v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
    • Kirsten rat sarcoma viral oncogene homolog
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1988-06-02
  • Entrez gene record
  • RefSeq identity
  • Classification
    • RAS type GTPase family
  • VEGA ID
  • Locus Specific Databases
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee