Rabbit ILF3 antibody
-
Catalog number70R-5643
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
-
SpecificityILF3 antibody was raised against the N terminal of ILF3
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ILF3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolILF3-DT, ILF3
-
Short nameRabbit ILF3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ILF3 antibody raised against the N terminal of ILF3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterleukin enhancer binding factor 3, 90kDa, CBTF and DRBF and DRBP76 and MMP4 and MPHOSPH4 and MPP4 and NF-AT-90 and NF110 and NF110b and NF90 and NF90a and NF90b and NFAR and NFAR-1 and NFAR2 and TCP110 and TCP80, ILF3 and IDBG-27975 and ENSG00000129351 and 3609, poly(A) RNA binding, nuclei, Ilf3 and IDBG-140179 and ENSMUSG00000032178 and 16201, ILF3 and IDBG-643329 and ENSBTAG00000040076 and 614936
-
Gene info
-
Identity
-
Gene
-
Long gene nameILF3 divergent transcript
-
Synonyms gene
-
Synonyms gene name
- ILF3 antisense RNA 1 (non-protein coding)
- ILF3 antisense RNA 1
- ILF3 antisense RNA 1 (head to head)
-
GenBank acession
-
Locus
-
Discovery year2012-08-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Divergent transcripts
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameinterleukin enhancer binding factor 3
-
Synonyms gene name
- interleukin enhancer binding factor 3, 90kD
- interleukin enhancer binding factor 3, 90kDa
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-11-15
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data