ILF3 antibody

• Catalog number
  70R-5642
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cytokines & Growth Factors
• Type of Immunogen
  ILF3 antibodies were raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD
• Raised in
  Rabbit
• Specificity
  ILF3 antibody was raised against the N terminal of ILF3
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ILF3 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• Usage Recommendations
  WB: 0.0625 ug/ml; IHC: 4-8 ug/ml
• Assay Information
  ILF3 Blocking Peptide, catalog no. 33R-7393, is also available for use as a blocking control in assays to test for specificity of this ILF3 antibody
• Additional Information
  This is a rabbit polyclonal antibody against ILF3. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ILF3  
• Gene symbol
  ILF3-DT, ILF3
• Short name
  ILF3 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal ILF3 antibody raised against the N terminal of ILF3
• Alternative technique
  antibodies
• Alternative to gene target
  interleukin enhancer binding factor 3, 90kDa, CBTF and DRBF and DRBP76 and MMP4 and MPHOSPH4 and MPP4 and NF-AT-90 and NF110 and NF110b and NF90 and NF90a and NF90b and NFAR and NFAR-1 and NFAR2 and TCP110 and TCP80, ILF3 and IDBG-27975 and ENSG00000129351 and 3609, poly(A) RNA binding, nuclei, Ilf3 and IDBG-140179 and ENSMUSG00000032178 and 16201, ILF3 and IDBG-643329 and ENSBTAG00000040076 and 614936

Gene info

• Identity
  HGNC:27115
• Gene
  ILF3-DT
• Long gene name
  ILF3 divergent transcript
• Synonyms gene
  • ILF3-AS1
• Synonyms gene name
  • ILF3 antisense RNA 1 (non-protein coding)
  • ILF3 antisense RNA 1
  • ILF3 antisense RNA 1 (head to head)
• GenBank acession
  • BC007593
  • BC044911
  • DB002247
• Locus
  19p13.2
• Discovery year
  2012-08-10
• Entrez gene record
  147727
• Pubmed identfication
  • 28935763
• RefSeq identity
  • NR_024333
• Classification
  • Divergent transcripts
• VEGA ID
  OTTHUMG00000180586

Gene info

• Identity
  HGNC:6038
• Gene
  ILF3
• Long gene name
  interleukin enhancer binding factor 3
• Synonyms gene name
  • interleukin enhancer binding factor 3, 90kD
  • interleukin enhancer binding factor 3, 90kDa
• Synonyms
  • NF90
  • MPHOSPH4
  • MPP4
  • NFAR-1
  • NFAR110
  • NFAR-2
  • TCP110
  • NF110
  • DRBP76
  • NFAR90
  • NF110b
  • NF90a
  • NF90c
  • NF90ctv
  • MPP4110
• Synonyms name
  • M-phase phosphoprotein 4
  • nuclear factor of activated T-cells 90 kDa
  • nuclear factor of activated T-cells 110 kDa
  • translational control protein 80
  • double-stranded RNA-binding protein, 76 kD
  • M phase phosphoprotein 4, nuclear factor associated with DS RNA
  • dsRNA binding protein NFAR-2/MPP4
• GenBank acession
  • U10324
• Locus
  19p13.2
• Discovery year
  1994-11-15
• Entrez gene record
  3609
• Pubmed identfication
  • 7519613
  • 8885239
  • 25447144
• VEGA ID
  OTTHUMG00000180587

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products