ILF3 antibody
-
Catalog number70R-5642
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchCytokines & Growth Factors
-
Type of ImmunogenILF3 antibodies were raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD
-
Raised inRabbit
-
SpecificityILF3 antibody was raised against the N terminal of ILF3
-
Cross ReactivityHuman
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ILF3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB; IHC
-
Usage RecommendationsWB: 0.0625 ug/ml; IHC: 4-8 ug/ml
-
Assay InformationILF3 Blocking Peptide, catalog no. 33R-7393, is also available for use as a blocking control in assays to test for specificity of this ILF3 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against ILF3. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolILF3-DT, ILF3
-
Short nameILF3 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal ILF3 antibody raised against the N terminal of ILF3
-
Alternative techniqueantibodies
-
Alternative to gene targetinterleukin enhancer binding factor 3, 90kDa, CBTF and DRBF and DRBP76 and MMP4 and MPHOSPH4 and MPP4 and NF-AT-90 and NF110 and NF110b and NF90 and NF90a and NF90b and NFAR and NFAR-1 and NFAR2 and TCP110 and TCP80, ILF3 and IDBG-27975 and ENSG00000129351 and 3609, poly(A) RNA binding, nuclei, Ilf3 and IDBG-140179 and ENSMUSG00000032178 and 16201, ILF3 and IDBG-643329 and ENSBTAG00000040076 and 614936
-
Gene info
-
Identity
-
Gene
-
Long gene nameILF3 divergent transcript
-
Synonyms gene
-
Synonyms gene name
- ILF3 antisense RNA 1 (non-protein coding)
- ILF3 antisense RNA 1
- ILF3 antisense RNA 1 (head to head)
-
GenBank acession
-
Locus
-
Discovery year2012-08-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Divergent transcripts
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameinterleukin enhancer binding factor 3
-
Synonyms gene name
- interleukin enhancer binding factor 3, 90kD
- interleukin enhancer binding factor 3, 90kDa
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-11-15
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data