Rabbit HRK antibody
-
Catalog number70R-6345
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Cycle & Cell Death
-
ImmunogenHRK antibody was raised using a synthetic peptide corresponding to a region with amino acids MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HRK antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolHRK
-
Short nameRabbit HRK antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal HRK antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetharakiri, BCL2 interacting protein (contains only BH3 domain), DP5 and HARAKIRI, HRK and IDBG-59297 and ENSG00000135116 and 8739, protein binding, Plasma membranes, Hrk and IDBG-195140 and ENSMUSG00000046607 and 12123, HRK and IDBG-633660 and ENSBTAG00000047484 and 787139
-
Gene info
-
Identity
-
Gene
-
Long gene nameharakiri, BCL2 interacting protein
-
Synonyms gene name
- harakiri, BCL2-interacting protein (contains only BH3 domain)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-05-21
-
Entrez gene record
-
Pubmed identfication
-
Classification
- BCL2 homology region 3 (BH3) only
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data