Rabbit HRK antibody

• Catalog number
  70R-6345
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Cycle & Cell Death
• Immunogen
  HRK antibody was raised using a synthetic peptide corresponding to a region with amino acids MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HRK antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  HRK  
• Gene symbol
  HRK
• Short name
  Rabbit HRK antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal HRK antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  harakiri, BCL2 interacting protein (contains only BH3 domain), DP5 and HARAKIRI, HRK and IDBG-59297 and ENSG00000135116 and 8739, protein binding, Plasma membranes, Hrk and IDBG-195140 and ENSMUSG00000046607 and 12123, HRK and IDBG-633660 and ENSBTAG00000047484 and 787139

Gene info

• Identity
  HGNC:5185
• Gene
  HRK
• Long gene name
  harakiri, BCL2 interacting protein
• Synonyms gene name
  • harakiri, BCL2-interacting protein (contains only BH3 domain)
• Synonyms
  • DP5
• Synonyms name
  • death protein 5
• GenBank acession
  • U76376
• Locus
  12q24.22
• Discovery year
  1999-05-21
• Entrez gene record
  8739
• Pubmed identfication
  • 9130713
• Classification
  • BCL2 homology region 3 (BH3) only
• VEGA ID
  OTTHUMG00000169328

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products