Rabbit HDAC9 antibody
-
Catalog number70R-5663
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenHDAC9 antibody was raised using the middle region of HDAC9 corresponding to a region with amino acids GQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVI
-
SpecificityHDAC9 antibody was raised against the middle region of HDAC9
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HDAC9 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolHDAC9-AS1, HDAC9
-
Short nameRabbit HDAC9 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal HDAC9 antibody raised against the middle region of HDAC9
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targethistone deacetylase 9, HD7 and HD7b and HD9 and HDAC and HDAC7 and HDAC7B and HDAC9B and HDAC9FL and HDRP and MITR, HDAC9 and IDBG-9049 and ENSG00000048052 and 9734, NAD-dependent histone deacetylase activity (H3-K18 specific), nuclei, Hdac9 and IDBG-134566 and ENSMUSG00000004698 and 79221, HDAC9 and IDBG-629964 and ENSBTAG00000003808 and 535415
-
Gene info
-
Identity
-
Gene
-
Long gene nameHDAC9 antisense RNA 1
-
Locus
-
Discovery year2019-08-07
-
Entrez gene record
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene namehistone deacetylase 9
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-09-06
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Histone deacetylases, class IIA
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data