Rabbit HDAC9 antibody

  • Catalog number
    70R-5663
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    DNA & RNA
  • Immunogen
    HDAC9 antibody was raised using the middle region of HDAC9 corresponding to a region with amino acids GQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVI
  • Specificity
    HDAC9 antibody was raised against the middle region of HDAC9
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HDAC9 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    HDAC9  
  • Gene symbol
    HDAC9-AS1, HDAC9
  • Short name
    Rabbit HDAC9 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal HDAC9 antibody raised against the middle region of HDAC9
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    histone deacetylase 9, HD7 and HD7b and HD9 and HDAC and HDAC7 and HDAC7B and HDAC9B and HDAC9FL and HDRP and MITR, HDAC9 and IDBG-9049 and ENSG00000048052 and 9734, NAD-dependent histone deacetylase activity (H3-K18 specific), nuclei, Hdac9 and IDBG-134566 and ENSMUSG00000004698 and 79221, HDAC9 and IDBG-629964 and ENSBTAG00000003808 and 535415
Gene info
  • Identity
  • Gene
  • Long gene name
    HDAC9 antisense RNA 1
  • Locus
  • Discovery year
    2019-08-07
  • Entrez gene record
  • Classification
    • Antisense RNAs
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee