HDAC9 antibody
-
Catalog number70R-1632
-
PricePlease ask
-
Size100 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchDNA & RNA
-
Type of ImmunogenHDAC9 antibodies were raised using the C terminal of HDAC9 corresponding to a region with amino acids QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
-
Raised inRabbit
-
SpecificityHDAC9 antibody was raised against the C terminal of HDAC9
-
Cross ReactivityHuman,Mouse,Dog
-
Method of PurificationTotal IgG Protein A purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HDAC9 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB; IHC
-
Usage RecommendationsWB: 1.25 ug/ml; IHC: 4-8 ug/ml
-
Assay InformationHDAC9 Blocking Peptide, catalog no. 33R-7773, is also available for use as a blocking control in assays to test for specificity of this HDAC9 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against HDAC9. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolHDAC9-AS1, HDAC9
-
Short nameHDAC9 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal HDAC9 antibody raised against the C terminal of HDAC9
-
Alternative techniqueantibodies
-
Alternative to gene targethistone deacetylase 9, HD7 and HD7b and HD9 and HDAC and HDAC7 and HDAC7B and HDAC9B and HDAC9FL and HDRP and MITR, HDAC9 and IDBG-9049 and ENSG00000048052 and 9734, NAD-dependent histone deacetylase activity (H3-K18 specific), nuclei, Hdac9 and IDBG-134566 and ENSMUSG00000004698 and 79221, HDAC9 and IDBG-629964 and ENSBTAG00000003808 and 535415
-
Gene info
-
Identity
-
Gene
-
Long gene nameHDAC9 antisense RNA 1
-
Locus
-
Discovery year2019-08-07
-
Entrez gene record
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene namehistone deacetylase 9
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-09-06
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Histone deacetylases, class IIA
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data