Rabbit HBXIP antibody
-
Catalog number70R-2217
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaInfectious Disease
-
ImmunogenHBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR
-
SpecificityHBXIP antibody was raised against the N terminal of HBXIP
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HBXIP antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolLAMTOR5
-
Short nameRabbit HBXIP antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal HBXIP antibody raised against the N terminal of HBXIP
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetlate endosomal/lysosomal adaptor, MAPK and MTOR activator 5, HBXIP and XIP, HBXIP and IDBG-100979 and ENSG00000134248 and 10542, protein complex scaffold, Cytoplasm, Hbxip and IDBG-489097 and ENSMUSG00000087260 and 68576, HBXIP and IDBG-648604 and ENSBTAG00000045839 and
-
Gene info
-
Identity
-
Gene
-
Long gene namelate endosomal/lysosomal adaptor, MAPK and MTOR activator 5
-
Synonyms gene
-
Synonyms gene name
- hepatitis B virus x interacting protein
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2002-01-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ragulator complex
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data