Rabbit GIPC1 antibody
-
Catalog number70R-4857
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenGIPC1 antibody was raised using the N terminal of GIPC1 corresponding to a region with amino acids SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA
-
SpecificityGIPC1 antibody was raised against the N terminal of GIPC1
-
Cross ReactivityHuman,Mouse,Rat,Dog,ZebraFish
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GIPC1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGIPC1
-
Short nameRabbit GIPC1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal GIPC1 antibody raised against the N terminal of GIPC1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetGIPC PDZ domain containing family, member 1, C19orf3 and GIPC and GLUT1CBP and Hs.6454 and IIP-1 and NIP and RGS19IP1 and SEMCAP and SYNECTIIN and SYNECTIN and TIP-2, GIPC1 and IDBG-33390 and ENSG00000123159 and 10755, protein homodimerization activity, Plasma membranes, Gipc1 and IDBG-172301 and ENSMUSG00000019433 and 67903, GIPC1 and IDBG-642673 and ENSBTAG00000000764 and 519617
-
Gene info
-
Identity
-
Gene
-
Long gene nameGIPC PDZ domain containing family member 1
-
Synonyms gene
-
Synonyms gene name
- chromosome 19 open reading frame 3
- regulator of G-protein signalling 19 interacting protein 1
- GIPC PDZ domain containing family, member 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-12-01
-
Entrez gene record
-
Pubmed identfication
-
Classification
- PDZ domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data