GIPC1 antibody

• Catalog number
  70R-4857
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  DNA & RNA
• Type of Immunogen
  GIPC1 antibodies were raised using the N terminal of GIPC1 corresponding to a region with amino acids SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA
• Raised in
  Rabbit
• Specificity
  GIPC1 antibody was raised against the N terminal of GIPC1
• Cross Reactivity
  Human,Mouse,Rat,Dog,ZebraFish
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GIPC1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  GIPC1 Blocking Peptide, catalog no. 33R-8461, is also available for use as a blocking control in assays to test for specificity of this GIPC1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against GIPC1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  GIPC1  
• Gene symbol
  GIPC1
• Short name
  GIPC1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal GIPC1 antibody raised against the N terminal of GIPC1
• Alternative technique
  antibodies
• Alternative to gene target
  GIPC PDZ domain containing family, member 1, C19orf3 and GIPC and GLUT1CBP and Hs.6454 and IIP-1 and NIP and RGS19IP1 and SEMCAP and SYNECTIIN and SYNECTIN and TIP-2, GIPC1 and IDBG-33390 and ENSG00000123159 and 10755, protein homodimerization activity, Plasma membranes, Gipc1 and IDBG-172301 and ENSMUSG00000019433 and 67903, GIPC1 and IDBG-642673 and ENSBTAG00000000764 and 519617

Gene info

• Identity
  HGNC:1226
• Gene
  GIPC1
• Long gene name
  GIPC PDZ domain containing family member 1
• Synonyms gene
  • C19orf3
  • RGS19IP1
• Synonyms gene name
  • chromosome 19 open reading frame 3
  • regulator of G-protein signalling 19 interacting protein 1
  • GIPC PDZ domain containing family, member 1
• Synonyms
  • TIP-2
  • Hs.6454
  • GIPC
  • SEMCAP
  • GLUT1CBP
  • SYNECTIN
  • NIP
• GenBank acession
  • AF089816
• Locus
  19p13.12
• Discovery year
  1998-12-01
• Entrez gene record
  10755
• Pubmed identfication
  • 9770488
  • 9482110
• Classification
  • PDZ domain containing
• VEGA ID
  OTTHUMG00000182248

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products