Rabbit FCER1A antibody

• Catalog number
  70R-6650
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  FCER1A antibody was raised using the N terminal of FCER1A corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK
• Specificity
  FCER1A antibody was raised against the N terminal of FCER1A
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCER1A antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  FCER1A  
• Gene symbol
  FCER1A
• Short name
  Rabbit FCER1A antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal FCER1A antibody raised against the N terminal of FCER1A
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide, FCE1A and FcERI, FCER1A and IDBG-103887 and ENSG00000179639 and 2205, IgE binding, Cell surfaces, Fcer1a and IDBG-205782 and ENSMUSG00000005339 and 14125, FCER1A and IDBG-630768 and ENSBTAG00000012887 and 506783

Gene info

• Identity
  HGNC:3609
• Gene
  FCER1A
• Long gene name
  Fc fragment of IgE receptor Ia
• Synonyms gene
  • FCE1A
• Synonyms gene name
  • Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
• Synonyms name
  • Fc epsilon receptor Ia
• GenBank acession
  • BC015195
• Locus
  1q23.2
• Discovery year
  1989-06-30
• Entrez gene record
  2205
• Pubmed identfication
  • 8245459
• RefSeq identity
  • NM_002001
• Classification
  • Immunoglobulin like domain containing
• VEGA ID
  OTTHUMG00000037176

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products