Rabbit FCER1A antibody
-
Catalog number70R-6005
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenFCER1A antibody was raised using the middle region of FCER1A corresponding to a region with amino acids IYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNIT
-
SpecificityFCER1A antibody was raised against the middle region of FCER1A
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCER1A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFCER1A
-
Short nameRabbit FCER1A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FCER1A antibody raised against the middle region of FCER1A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFc fragment of IgE, high affinity I, receptor for; alpha polypeptide, FCE1A and FcERI, FCER1A and IDBG-103887 and ENSG00000179639 and 2205, IgE binding, Cell surfaces, Fcer1a and IDBG-205782 and ENSMUSG00000005339 and 14125, FCER1A and IDBG-630768 and ENSBTAG00000012887 and 506783
-
Gene info
-
Identity
-
Gene
-
Long gene nameFc fragment of IgE receptor Ia
-
Synonyms gene
-
Synonyms gene name
- Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1989-06-30
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Immunoglobulin like domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data